DPCstruct | MC25412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 209 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8ZCC4 | 1-214 | MRVPRRFIYSLVALLSLLIALGSGLLTGKTDSPAIAQPAPLSIPLTTYRGAPVLDPTQFTFASLPPFATRGSLQAPGSAIAALGYDP… |
| A0A2H2XT50 | 1-215 | MKRFRFVTIFILSLSLLLVVWFRPWHLVVSNAEVFKQPKNDLPTRLLATSTATNALLPDWSRISFSTMPPISESGSIKVDGIERKWR… |
| A0A6P0WVH0 | 7-222 | None |
| A0A2T1LR53 | 1-222 | None |
| A0A351LCM2 | 10-210 | None |
| A0A1U7J9E7 | 1-190 | None |
| A0A1Q2U1W0 | 1-197 | None |
| A0A6P0X917 | 1-213 | None |
| A0A1Z4R557 | 2-210 | None |
| A0A6B3M9F2 | 7-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.