DPCstruct | MC2541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 210 ± 31 aa |
| Standard deviation of domain lengths | 31.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4SNQ6 | 3-177 | YQFCIQHKVTFKYISNYRNLLTNLSGKSSIWSSRKSITIYPKDVHTFKKIIAKLYSLFTLHEIHKGIAILSDRRFKDSNVLFYRYGV… |
| A0A5P8KFH3 | 17-197 | VWDYCVPRSIPFKFVPGPRLLHLRNAKYASRDTSGKFVTIYPADEEGLHFVLRELGALLDGLDGPYILTDLRWNEGPLYVRYGAFAR… |
| A0A1Q8JQY3 | 1-183 | None |
| A0A3G5HRQ1 | 34-265 | None |
| A0A2I1WGW1 | 25-268 | None |
| A0A6I7YE13 | 3-223 | None |
| A0A0R1U798 | 7-227 | None |
| J1NWY8 | 8-145 | None |
| A0A828UK40 | 1-199 | None |
| A0A7H1LFC3 | 6-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.