DPCstruct | MC25405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 255 ± 40 aa |
| Standard deviation of domain lengths | 39.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6LGK5 | 55-241 | TLFLFGTGPFTLSGINVIGGVRVVISESVTSMVAFSNLTLRATGDNRCAFALETNACVSLFLAGENTLMSGENRAGIEVAAGRTLSV… |
| E3GNU6 | 31-281 | FSQMAMAEEQPTDTLNIENGNISISEVGKATQTGNTYTFSNDRGLRLTGTSDQYGITVRYGVGTGNPVKLKLDNLQIDTSKNDLCAF… |
| A0A840S5P4 | 753-1043 | None |
| A0A7W6HVI8 | 315-526 | None |
| A0A7V6HIS7 | 144-441 | None |
| A0A7C6UGZ8 | 146-393 | None |
| A0A1H0FS42 | 244-478 | None |
| A0A1I5HRB1 | 17-289 | None |
| A0A369LLG2 | 648-950 | None |
| R6RIH3 | 2-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.