DPCstruct | MC25401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 307 ± 74 aa |
| Standard deviation of domain lengths | 74.42 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 73.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1NS01 | 3-176 | TINSPQLLKTLKELVRFSPSESLDFDTQVSYDSPYNLLHHHRAELLEYKKTSADETALEHIDLLLLFLASEASDKGRVATKLIASGL… |
| A0A6A6W782 | 101-430 | KSDKKLSTGSMPTAESYPVPFMPLAPGSMPPSFPPSMPPPPSCGAFDFNAPSADESGNKEPSPNSEADFDVKHLYAFGRCICSQCVF… |
| A0A4Y8CSE5 | 13-303 | None |
| A0A5N6U119 | 10-214 | None |
| C9SU39 | 60-422 | None |
| J3PFG7 | 44-322 | None |
| A0A0C3D8M7 | 208-535 | None |
| A0A4Q7K933 | 4-228 | None |
| A0A2J6TN52 | 70-259 | None |
| T0L8H4 | 398-730 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.