DPCstruct | MC254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z1NEF5 | 2-92 | HVEASGVATFRVNATGQKVSVSASDLEWDCQGDGERNMGPELIHTADFDISGHTVTWSIWEYPVGVENHSDTHVPDGITLVADIDYG… |
| A0A1G3JQ48 | 3-99 | TIYSRGIARIRHATTGEIFTIAADELEWAEFAADERQMGTEIGYSAEIEHPSLGTISWELWEYPVGAENMRETHTNGHVLIENIDFG… |
| A0A1C3RHK0 | 2-103 | None |
| R6G3A6 | 1-97 | None |
| A0A841LKE4 | 2-94 | None |
| A0A8B2C4M0 | 1-85 | None |
| A0A1R3T5I7 | 370-464 | None |
| A0A6P0V8A7 | 1-99 | None |
| A0A077Y2A4 | 321-420 | None |
| A0A1Y5T5D2 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.