DPCstruct | MC25397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 65.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9AWS7 | 1-60 | MTVYVSDEELLALEHARLELRGEHGLAVDRGRVVREAIAIVLDDLEEHGGDSPLVRRLRE |
| A0A0K3BLU5 | 9-77 | QKHDTKITVYVSDEELLALEHARLALRGKHGLAVDRGRVVREAIAVLLADLDEYGEESMLVRRLRQENG |
| A0A4Q8CB47 | 193-273 | None |
| A0A255EPA5 | 1-84 | None |
| A0A384HXY7 | 119-195 | None |
| A0A1E7K3L4 | 154-224 | None |
| A0A6I4MH47 | 73-146 | None |
| A0A160VNN6 | 1-67 | None |
| S2W2C1 | 37-116 | None |
| A0A852ZNX3 | 337-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.