DPCstruct | MC25395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 118 ± 22 aa |
| Standard deviation of domain lengths | 22.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178XGU1 | 1-83 | MSYHLDAWGATARKVLLGGRIVRLEGFRATDPDTVEAIGTDSRRVRLLVVPREAPGGAARAVLRSAADGDSTATAADILAGNG |
| A0A0K3BFL4 | 11-125 | VDGGWWPRSNDPMAEFPALLTALAPWVGAVTRVSYHLDTWASVERKVPIGGRAVRFEGFHSMDRNTVTVIGTDSRRISLLVVPPDTS… |
| A0A3P8L3P8 | 1-92 | None |
| A0A286HZU8 | 45-209 | None |
| A0A0S9R7A5 | 18-143 | None |
| A0A810KUX4 | 73-220 | None |
| A0A2T2ZKP7 | 51-163 | None |
| A0A7I9WM11 | 1-135 | None |
| A0A7X6RKZ6 | 1-76 | None |
| A0A4R4V859 | 87-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.