DPCstruct | MC25393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.99 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0D290 | 1-64 | MSTPREEVSEELDEDRLGVDPLEEGVEPPEHWSGVDQHGTTPNEQREGETLDERLAEERPDVEP |
| A0A0K3B0U6 | 1-67 | MTSPPDPDMTTSEQLDEDELATDPLERGAEPAEGWSGADRFGTTEREQRSGAPLDERLREEEPDVPE |
| A0A229SWX5 | 12-88 | None |
| A0A7I7SEH0 | 6-84 | None |
| W5WBJ5 | 1-72 | None |
| A0A841P641 | 1-78 | None |
| A0A542DMI3 | 14-84 | None |
| A0A850DIS4 | 11-84 | None |
| A0A428ZA06 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.