DPCstruct | MC25391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 168 ± 34 aa |
| Standard deviation of domain lengths | 33.57 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q08PD8 | 10-154 | EPVAKKTFQVALKGAGSLLFVPVLDFTVQPPLRLHLVQDGKILHTLSSSAADKAWPILQFEDVSFKDVNGDGFEDILTLARYMPGVG… |
| A0A1Z4FZ29 | 30-217 | ITSIAAEFPKNPIVESQTKQLRPTKITPDEIGQIRQALPRRNILVKHAFRVNLPDFGSCIFVPVQEFLKGSKKAKLSLYLVKNNRVI… |
| A0A0P9HLB5 | 2-133 | None |
| A0A2T5H0T1 | 321-503 | None |
| A0A3R8ZTV1 | 17-177 | None |
| A0A0Q4CGL7 | 9-195 | None |
| A0A396RPS3 | 1-111 | None |
| A0A5D0CJK9 | 204-382 | None |
| A0A2N9YIH7 | 32-174 | None |
| A0A520IE99 | 10-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.