DPCstruct | MC2539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 94.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8P0S7 | 52-166 | NNEYTNYEYLFAHQGKSMTADDVKKAQAAHGVTVVEIVKKNGQWVVDKSGERNRRITANTEMMLTGPAAGHALLKTQADASGTKVLG… |
| A0A378QYR8 | 32-143 | LANDVRREIHVHGVSVAEVKRTPTGYELIKDSPFNKRYTSGTPARLSGVAKGSEFVKTRLDPKGLLSVGINNQCGAGLSPWGTYLTT… |
| A0A285VPN1 | 222-319 | None |
| A0A508ZBJ5 | 113-243 | None |
| A0A6G3VBX0 | 77-206 | None |
| A0A522DD55 | 159-251 | None |
| A0A774NA18 | 68-194 | None |
| A0A379Y155 | 15-141 | None |
| A0A4R4GZD1 | 1-111 | None |
| A0A164YZB5 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.