DPCstruct | MC25386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.32 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | PF00699- PF18473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5AU58 | 1-71 | MIPGQYQIQPGDIELNAGRRTLSLTVANSGDRPIQVGSHFHFFETNDALTFDRAASRGMRLNIPAGTAVRF |
| A0A388T0A7 | 144-237 | VLPGPADPEPEPAVRLTVRNTAAVPVSVTSHFHFFEANPRLDFDRAAAYGMRLCVPAGSSVRFGPGDEVRVGLVPIGGGRVVIGFAG… |
| A0A813BR20 | 25-127 | None |
| A0A6A3B9W3 | 11-100 | None |
| A0A6A3B592 | 96-185 | None |
| G8PTQ7 | 1-61 | None |
| A0A6B3QRS7 | 7-123 | None |
| A0A840W1C2 | 83-171 | None |
| A0A2I9DBP4 | 14-109 | None |
| A0A2T7PPG9 | 446-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.