DPCstruct | MC25380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 156 ± 10 aa |
| Standard deviation of domain lengths | 10.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5WD18 | 1-186 | MRWQDEQTQQDVKLRQSNRPDTGFLSWSNYIKVHKEDAAKRYEVAQAFLPWPLGFKESVLALRALIRDKKKQQVDFESELHSLYHLA… |
| J1YDG8 | 34-182 | GEFWADTIKKYHDDPDKRLTIALDNLPLPGAFREAKIALRATIRSKRKSKQDYADELELIYRLAVIESFSIPYSKRLKMPGYNVIEH… |
| A0A0W0ZMX8 | 34-195 | None |
| A0A2J6H1Z9 | 14-164 | None |
| A0A2W6WE93 | 33-190 | None |
| I9C2E6 | 42-195 | None |
| A0A1H8A7F6 | 190-342 | None |
| A0A7Y3E3J8 | 7-161 | None |
| A0A0S2KCT0 | 65-220 | None |
| A0A2E6BJE6 | 99-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.