DPCstruct | MC25368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 186 ± 24 aa |
| Standard deviation of domain lengths | 24.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0MSU8 | 8-173 | SDEQYQASLDRIERLGSEFTDSQQFKRLTTHQQREAQFVIGTFHELLYGYEYVPLDDPDEHSLETVCRDLYPAKISSEPDHFETVAS… |
| A0A7X2XTH1 | 2-158 | TFDNQLDQWLDQIDSTPMMNNLTEDQRRQVELIVTITAQVLVEGYGMQPEDWTAAQLNDLFINRFVQLLNADEKKATLFALIPTALS… |
| D0LS19 | 442-634 | None |
| A0A1M3GVK7 | 16-203 | None |
| A0A1Q9RZU7 | 5-189 | None |
| A0A1G2Z1L7 | 303-483 | None |
| A0A842TAU4 | 84-233 | None |
| A0A0R1KCH1 | 146-324 | None |
| A0A7J9Y5C2 | 97-302 | None |
| A0A524FNF2 | 139-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.