DPCstruct | MC25367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 188 ± 25 aa |
| Standard deviation of domain lengths | 25.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840GVY5 | 33-233 | VLLSGLLSDGAAGLNAIKRCGGMTVVQDPSDAISDEMPLRAMEATTVDLCVPGAGMGDVLSELAREQAGAVLPIPPEIRLEVQIAAG… |
| A0A1E3VHT5 | 2-197 | LAIKDRGGFTIVQEPGEATSRSMPLSAIRHVSVDRVCTLDEMARLFVELANDAPPPDDQTLQRLMQIENRIAGGIFRVEDWWELERM… |
| A0A536I177 | 1-167 | None |
| A0A7Y9LKT8 | 21-215 | None |
| A0A6J4RQ93 | 1-165 | None |
| A0A0D3LA92 | 2-217 | None |
| A0A1I1AFQ5 | 55-276 | None |
| A0A2T0SJR2 | 2-138 | None |
| A0A7C3NLW4 | 250-468 | None |
| A0A537QN64 | 107-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.