DPCstruct | MC25366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.59 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0039- CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2ILH0 | 12-92 | CLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPV |
| A0A6A5AR81 | 11-89 | ASLRLKMQLDSPNPNMWDFVAYRIKFVPHPHIGSKWCIYPTYDYTHCIVDALEHIDYSICTLEFETRRESYYWLLDVLD |
| S3CKI6 | 627-748 | None |
| A0A821T1D3 | 80-160 | None |
| A0A0V0QMA6 | 209-287 | None |
| A0A1V6SBU2 | 284-382 | None |
| A0A6J5VQP7 | 11-94 | None |
| A0A151HCF9 | 411-500 | None |
| A0A812IRP9 | 162-243 | None |
| A0A158N7S1 | 376-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.