DPCstruct | MC25361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 166 ± 24 aa |
| Standard deviation of domain lengths | 24.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.00 |
| Pfam Score | 81.51 |
| Assigned Pfam label(s) | CL0431- PF10240- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C8V5W2 | 3-138 | YLQSIDVRYGEDPSSEPSDGIHTVDGTNADINAGFGGDFVWLVPRYNSNAANAVSNIRIIIQGDPDSAYVDLAKGAGGDYRYLRLER… |
| A0A6A5A901 | 172-348 | DSDEDENADDDDAPPTPLPITDLVVVFSGDVTPEDFEKIEKSPSGIKADLNRGRRGQFVYLCQKREIPSSYGYKRPPISDIILIYPE… |
| A0A654HIH5 | 3-139 | None |
| A0A6A3T3P2 | 154-323 | None |
| A0A0K0E693 | 38-224 | None |
| A0A1L9WMM2 | 349-492 | None |
| A0A0C2J764 | 27-196 | None |
| A0A7N8XYW5 | 5-155 | None |
| A0A416IGT4 | 29-215 | None |
| A0A433Q995 | 88-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.