DPCstruct | MC2536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 276 ± 34 aa |
| Standard deviation of domain lengths | 33.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14256 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084EY76 | 4-218 | VPFIYGISASHFVMNHFWLGLSWFFTYLFSYPFFSVVSKKQNEKYKRWMIIYAVFSGIFIFPVLLSHFSILQFIIPILPLAGFQIYY… |
| C0W4P1 | 61-366 | RPRGAGEPTPVRERVEAAKERQEQIRRQPGRKAWIPNQHGAWSMLVLPPLVGWVVGGVSWKNLLLLPAWWSAYLTYWAWSQWLRTRS… |
| A0A261FRB1 | 73-408 | None |
| A0A3C0MPH2 | 8-308 | None |
| A0A087VV01 | 2-252 | None |
| A0A095WU50 | 8-258 | None |
| K6UMP9 | 18-275 | None |
| A0A2N5J7X9 | 2-297 | None |
| A0A0K2SPX1 | 3-312 | None |
| A0A1W9W8B2 | 29-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.