DPCstruct | MC25359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 210 ± 21 aa |
| Standard deviation of domain lengths | 21.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8VL24 | 389-629 | GIFFYIISVVLNIINNLWGKSYLYLPIHLICQLLPFWFYTYQTFVFLTTFIPMQGRSGTTSKPEFMIAGICAIMSIHFGGFILPILH… |
| A0A6A4ZRE4 | 1-206 | MPDVPFNLLGTTLALVVGPAIPLVYFLQVDFMVLQVFIPIMGRVGNILPVDCIMAVLLSILTTITLSAITPLLCLVRPSSLHVLHKY… |
| A0A7J7KM47 | 7-228 | None |
| A0A4Z2BHZ9 | 331-569 | None |
| A0A3B4ZYU5 | 74-289 | None |
| A0A6F9CU64 | 643-878 | None |
| A0A498NYU5 | 1-187 | None |
| A0A7R8X158 | 543-746 | None |
| A0A3Q0IYB4 | 187-438 | None |
| A0A3Q0IT17 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.