DPCstruct | MC25358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4ZQ79 | 1-103 | MFALVGIVITDDTFYQLAQPNVPIRIEMRGRTIHVEGQVFRFQMSLFEEKLLNGGGIIPLYKKFGNRLFRVAVEDAEADDGAASCAT… |
| A0A2U1J6W8 | 164-253 | LLGIILKDERFYELAQEGSTVNVNLEGRVVECGGEKFSFNLSLMEERLINGGGVTEMYKKYGNQLFRAAISANPDAFLSKGACEDTA… |
| A0A7U2I8B8 | 1-93 | None |
| A0A0S7E267 | 708-796 | None |
| A0A135LVI0 | 349-449 | None |
| A0A5N7A1A4 | 259-345 | None |
| A0A2P2H6V5 | 740-839 | None |
| A0A2J6RZE5 | 1010-1099 | None |
| A0A094DAT9 | 995-1094 | None |
| A0A2I2F588 | 84-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.