DPCstruct | MC25356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 249 ± 36 aa |
| Standard deviation of domain lengths | 35.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6MDQ0 | 2-248 | TYNFIISREDWSLHRKGEVDQHRHREKVREAIKKNLADIVSEEGIILSDGRRVVKIPIRSLEQYRFRYDSRKQKHAGQGDGKSKVGD… |
| A0A376KSW2 | 2-273 | VNRQRFLRRYKAQIKQSISEAINKRSVTDVDSGESVSIPTEDISEPMFHQGRGGLRHRVHPGNDHFVQNDRIERPQGGGGGSGSGQG… |
| U1Q989 | 2-290 | None |
| A0A5J4KTL2 | 1-210 | None |
| A0A7T5JTL1 | 1-222 | None |
| W0BIQ9 | 1-287 | None |
| A0A6D0M2F2 | 5-248 | None |
| V4YHG2 | 2-318 | None |
| A0A0A2W387 | 648-923 | None |
| A0A2H0P321 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.