DPCstruct | MC25355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 180 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376RYA1 | 300-497 | AMALAQLRGHTLPLRTDWLDALAGSLIKEALNAPLPWSYRGVIHPDTDPILLTLIDTLAGDGFGKLAPSTPQPPLPKDVTCELERTA… |
| A0A376KR64 | 1-174 | MAAAHLHAMALAQLRGHTLPLRTDWLDAIAGSLIKEALNAPLPWSYRGVIHPDTDPILLTLIDTLAGDGFGKLAPSTPQPPLPKDVT… |
| A0A376U6X3 | 122-316 | None |
| A0A6I1YKG1 | 370-524 | None |
| A0A066Z0L2 | 322-488 | None |
| A0A354PHK8 | 2-189 | None |
| A0A535E5U7 | 210-395 | None |
| A0A7X6KGC2 | 15-169 | None |
| A0A4Q3X6P9 | 97-288 | None |
| A0A4D4L8W0 | 177-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.