DPCstruct | MC25354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 126 ± 28 aa |
| Standard deviation of domain lengths | 27.54 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 93.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4FYF4 | 62-210 | VFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKNSGLIVAHLGNGASICAVRNGQSVDTSMGMTP… |
| A0A376KQ87 | 186-274 | EELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDAINKLLTKESGLLGLTEVTSDCRY… |
| A0A841JRH6 | 150-298 | None |
| A0A438N6D0 | 155-311 | None |
| A0A378AXI9 | 97-199 | None |
| B4RI48 | 149-289 | None |
| A0A2X3J4X5 | 103-196 | None |
| A0A0F2IYR3 | 80-226 | None |
| A0A7Y5M7C0 | 1-102 | None |
| A0A447N887 | 7-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.