DPCstruct | MC25353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021- PF02272 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376KMB7 | 1-93 | MRDALERLDTLYPGMMLKFGGHAMAAGLSLEEDKFELFQQRFGELVTEWLDPSLLQGEVVSDGPLSPAEMTMEVAQLLRDAGPWGAD… |
| A0A0B0I377 | 3-102 | KGSARSIPGLDIYEALTSCKELMDHYGGHPSAAGMSLHKDQLQAFEEALNRFAAAAMTEEDYIPVTAADGEWKLSDVPLDVIDEIEM… |
| A0A0G0RMU4 | 295-411 | None |
| H1D3X9 | 24-108 | None |
| A0A7V9IY50 | 2-78 | None |
| A0A378MZ48 | 100-191 | None |
| A0A3D0USK3 | 1-84 | None |
| A0A377VBA8 | 53-163 | None |
| A0A451ARW9 | 643-748 | None |
| A0A812ZQ82 | 341-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.