DPCstruct | MC25352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 58.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5VS80 | 31-139 | RKKWFLPTSGAPDFSVRFHGRPAGNPGGPAAGPHTQMAHNLLLSYAAGGRILELKTVQVDDRLAIGRPCIDMTNVGYNIEWSQELLV… |
| A0A376KM85 | 1-108 | MNTNNNAQSLVFPEQQFYSPVKGKTVSVFGETCATPVGPAAGPHTQLAQNIVTSWLTGGRFIELKTVQILDRLELEKPCIDAEDECF… |
| A0A376W7M7 | 28-143 | None |
| A0A496ZR97 | 29-144 | None |
| A0A7V0JTQ1 | 28-140 | None |
| A0A4U9D216 | 28-145 | None |
| A0A4U9UGI1 | 1-132 | None |
| C7RE38 | 28-130 | None |
| A0A376MIU6 | 28-143 | None |
| A0A3P5VRM6 | 28-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.