DPCstruct | MC25351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 168 ± 18 aa |
| Standard deviation of domain lengths | 18.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 96.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3MAT1 | 154-331 | GKNLLFTGNNGEVVLQNSVNQGGGYLQFAGDYRVSALNGQTWMGGGIITDKGTHVLWQVNGVAGDNLHKTGEGTLTVNGTGVNIGGL… |
| A0A376KIR9 | 18-185 | VSGGGELTLKQDTDLGIGGLIFDKNQTYKVSGKDKSYKGAGIDIDNNTTVEWNVKGVAGDNLHKIGSGTLDVKTAQGNNLKTGNGTV… |
| A0A4U8TH89 | 12-183 | None |
| A0A378NFS1 | 341-518 | None |
| A0A378NJC0 | 359-536 | None |
| A0A378F342 | 303-486 | None |
| A0A6G3I6H7 | 2-142 | None |
| A0A2X5PFE9 | 327-483 | None |
| A0A243V4M1 | 260-444 | None |
| A0A1V4AYF1 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.