DPCstruct | MC25350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 7.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1I0I2 | 36-99 | ADKLAAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVLPTPEDQLPVILPEDVVMDGI |
| A0A376K096 | 1-62 | MGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVVMDGITSPD |
| A0A2C6MD49 | 42-108 | None |
| A0A0A9DPE7 | 69-137 | None |
| A0A257S8B4 | 66-128 | None |
| A0A842Q7H4 | 119-178 | None |
| W4TYN7 | 75-153 | None |
| X0QHZ0 | 109-171 | None |
| A0A091C9B5 | 11-87 | None |
| X0QAY1 | 130-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.