DPCstruct | MC25341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842S1J2 | 1-66 | MTCKDIVIKYLKDNGYDGLASNVCGCNIEDFNACDETFENCKPGYETEDETGEFSYIITTEKPMKK |
| A0A6H1ZHK9 | 1-70 | MEVSQIVEQYLKANGYDGLVSFAGECSCRIGDLMPCDYDCIANCEAGYKVPCTCGEGCEFHIATKKPKEE |
| A0A7V1BXB1 | 25-94 | None |
| A0A661TPZ6 | 1-73 | None |
| A0A0F9XHG2 | 23-90 | None |
| A0A0F9N8E9 | 1-81 | None |
| A0A0F9K9X6 | 1-66 | None |
| A0A7C2A125 | 1-57 | None |
| A0A2D6FK43 | 1-72 | None |
| A0A6M3LE19 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.