DPCstruct | MC25335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348ZZU6 | 30-149 | MKVSDDYVRQCEKAKEIQGLWNPDVGDWIYSYGSRSIEKVFGEVTMRYTKVWLPVQEDLQAILRYETPLVMLQAFNDWLYTDSGYGC… |
| A0A6H1Z984 | 1-133 | MDTSETNVKMCEKAGEIQDVWVYMLGDFFADRDRDWGISHKTVEILREKNLTWLPRQDQLQKMLGWNVKKLVSELDDFLFVDDDYGK… |
| A0A661AAI7 | 1-145 | None |
| A0A109BW79 | 1-133 | None |
| L0KWF5 | 1-129 | None |
| A0A0F9NWM6 | 1-115 | None |
| A0A7C3AN57 | 14-163 | None |
| A0A523WI45 | 1-133 | None |
| A0A0F9RG06 | 27-167 | None |
| A0A0F9JUT2 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.