DPCstruct | MC2533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 174 ± 19 aa |
| Standard deviation of domain lengths | 18.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0L1A9 | 69-258 | MRKRLRIGLFLIAIVVLIGGFKIYKYYQNHYVSSKIFENILERKEYSINKEDKVNVEIAIKPEWIPFETDKPQNQNIELDKSHNTNI… |
| A0A5J5GB66 | 13-163 | LQKIVTKKNYIVNKVEANLAIHFTIKPEWITKKSKRLNVKVFKVGESEIFLSDVVYRERDIYFSFHTSLNLQEEGRFIFPGDLKQNG… |
| A0A1M5MZV2 | 1-190 | None |
| A0A0F2PKM6 | 14-178 | None |
| A0A1I5SGU5 | 32-238 | None |
| A0A7Z0W2G2 | 4-155 | None |
| A0A3D9SD49 | 16-183 | None |
| A0A1Y4EVW8 | 71-249 | None |
| F3ZX52 | 1-150 | None |
| A0A1Y5K8U0 | 14-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.