DPCstruct | MC25326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 20.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A161I3M0 | 1-137 | MTEAKANGKFLSDVVDVSWAGLKKAHAPINYLRALLRKPVDFAYRARQLRNQTVLQQREATENAEVTATVARCVGQSFYDAIGTRRI… |
| A0A375JCY1 | 45-181 | KAGFFKLMGLAKTRGKRLSDIVTAMDHRLGEAKGGRLYAYLAALAAGPTDFAVAAAQVRAARRQAEDATRLQHRIARFKSRFGGATL… |
| A0A2N5C6W9 | 1-125 | None |
| A0A248VYT0 | 3-146 | None |
| A0A4R0WYR4 | 3-127 | None |
| A0A179BN99 | 9-222 | None |
| A0A2D2DWG0 | 3-136 | None |
| A0A328X8P8 | 118-256 | None |
| A0A192B172 | 1-137 | None |
| A0A0F0DLQ9 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.