DPCstruct | MC25323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 196 ± 41 aa |
| Standard deviation of domain lengths | 41.04 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF08928- PF08929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A375J750 | 15-210 | IHAHYSAGGSLDELREFFPKVVSSWEVFAKYHVMFHGTPIAGTRKVPHLDLYDGDYWSAIRLTSLAILLRHSSLLPSIAALWDYEND… |
| A0A3G9JT17 | 12-216 | FDEYIAYQKKRIDRKEKKLQVSLYDKAKCERINLSLITYKVNLVIAEYSAGYSLRIIRKTVDDALDTIIEMEKPGFEPVLNLLAFQV… |
| A0A375EU01 | 18-175 | None |
| A0A0Q7XFC9 | 4-246 | None |
| A0A428BKY4 | 5-171 | None |
| A0A136LAA1 | 19-168 | None |
| A0A6J5JCD1 | 226-483 | None |
| A0A7X9CC89 | 8-209 | None |
| A0A1N7QH03 | 7-253 | None |
| A0A5P2SLK1 | 272-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.