DPCstruct | MC25322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 191 ± 33 aa |
| Standard deviation of domain lengths | 32.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05983 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0YMA0 | 22-184 | FPPPPAFYKLYGTSADGSEVPAPPPPPPPVEGEYQLFGELYTTEDGIPPLTVRQLFTVNAQGLLDFKGELRRLNKELLFTFLDLLDC… |
| A0A4P9ZKI3 | 6-188 | ISALYPPPPIYYKYFTKSNLDKFKALDDPALITGELKLQVPPEIPQSAHYRGYGSVWSLETKIPSLKSLGFTQLYQDEDEIITSKTK… |
| A0A1R2CEK5 | 3-156 | None |
| A0A7J7QMN1 | 6-181 | None |
| U6K0Z9 | 69-247 | None |
| A0A2P5XWF3 | 3-138 | None |
| A0A0M8MJX1 | 1-259 | None |
| A0A0V0JCC7 | 13-206 | None |
| A0A5N3W492 | 10-188 | None |
| A0A6P6S562 | 37-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.