DPCstruct | MC25321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 63.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9YTT1 | 220-371 | SSNGHTNNNNNNNGSSSASPAPERSEPISKAAAMTNSLPARAMTAGTSTGSDMHAAHVVASGASTTRFACPDCGKLYKHPGCLGKHR… |
| A0A4P9ZGW3 | 1-124 | MATSTSQGRRHSSAYPYAIPSKGIHKLNGTHGDRATGFPTLLRSFVIRRTSGGETGRLKELLRCETCGKAYKHISSLAKHFWELTPE… |
| A0A2G5B9E6 | 1-108 | None |
| A0A1L0D664 | 1-161 | None |
| A0A2H9TJE3 | 21-180 | None |
| A0A1V8SPJ3 | 1-142 | None |
| A0A0C2YZC9 | 44-144 | None |
| A0A1J5WN15 | 15-159 | None |
| A0A3M6ZSH8 | 65-236 | None |
| A0A1E4TC12 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.