DPCstruct | MC2532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 221 ± 21 aa |
| Standard deviation of domain lengths | 20.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 16.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316BVP7 | 34-215 | MSSEESIAYIHKLRDKLTKIEKLEHEVADNEARLAKPLELNYRSYSFFRFFWPYLVGSLCTLYFFGLIFAMTSDNGRANFVSFLFVS… |
| R5KDV2 | 3-224 | RDELIAELEAIMPIVNKWERLSNLIAQNQRSINELNFNIRNEEPTFSNIMAMAFISILCCFSFDGIVFLMIKLSSSIKITFLFYFVF… |
| A0A2R5HGJ6 | 2-205 | None |
| A0A533IQ91 | 4-232 | None |
| A0A316BFL9 | 1-244 | None |
| A0A1H3HY42 | 210-459 | None |
| A0A3A8W525 | 1-209 | None |
| A0A1M5QK24 | 81-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.