DPCstruct | MC25318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 48 ± 3 aa |
| Standard deviation of domain lengths | 2.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 57.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074ZG85 | 331-376 | VVLQRDNNIGYIKCTICLEDFQTKINYLSQEIDVYNDWIDACEEAN |
| A0A7M7RGD1 | 36-82 | DVKMDRTRNVGVISCRVCLEDFQTSITYLSEPVDVYSDWIDACEQAN |
| A0A7J6ZSE3 | 90-136 | None |
| H3HB17 | 343-391 | None |
| A0A6N2AZQ0 | 19-67 | None |
| A0A4Y1R9U1 | 190-239 | None |
| A0A3N7HI58 | 75-123 | None |
| A0A6I9YBC5 | 3-49 | None |
| A0A7S1KNX9 | 53-98 | None |
| A0A4W3H3F0 | 1-45 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.