DPCstruct | MC25315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 100 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A389MNK5 | 1-101 | MQAAEIRFDGGVFWGVQYHPETGLDEVAGALRRQADSLVEAGLARGEDDVEAYALQVDALHREPNRRDLAWRLGLDEQVTDERLRLA… |
| A0A7C3BJ55 | 300-395 | QALSVKHGKGEFWATQYHPEFTLYEMARLIIARWSALVKEGFFENEADVTALVDKMTALSKNPQNAALGQELNIGDDILDDAIRQSE… |
| A0A259JKP6 | 1-103 | None |
| A0A0W8CR67 | 38-145 | None |
| A0A3L6VTC7 | 132-231 | None |
| A0A537IHP2 | 73-172 | None |
| A0A534DQL8 | 88-181 | None |
| A0A1M7ZQA5 | 64-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.