DPCstruct | MC25313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 50 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327KXG9 | 1-45 | MARFRNHYRCPTCDCTWSDDWDATCDDDCPNCGARHISPEESEDI |
| A0A389MLA0 | 2-52 | MDDEPIRFRNYYRCDDCDVEWSDDWSCCCDDECPSCGRDYTPTHSEDLEEE |
| A0A1M5NFE8 | 12-63 | None |
| A0A1P9YFA0 | 1-60 | None |
| A0A4R3XRA4 | 15-66 | None |
| A2SNC2 | 99-143 | None |
| A0A6I1JAR6 | 1-44 | None |
| A0A318L5Q0 | 97-152 | None |
| A0A291IQ78 | 9-56 | None |
| A0A165TJC4 | 136-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.