DPCstruct | MC25310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 181 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428T1C3 | 90-272 | APRMVSFLETLQRKKSVQHIGQPERMLIDNAVYYVDPPERPAIEQKERTPMELFVRKLIYVDMTKRNYSKILKQIRRLHWEETEVVA… |
| A0A2S7QQN7 | 4-177 | RMASFLDTLKRKKSVQHIGQQERMLIENAVYYVDPPMRAAIQQKERTPVHLFIRKLIYSDMNQRNYTRIIKQIRRLHWEEAEVVTIL… |
| A0A177B4J9 | 22-197 | None |
| A0A7J7KU23 | 273-445 | None |
| Q54TQ1 | 876-1063 | None |
| A0A7S0R638 | 26-222 | None |
| E3MS85 | 592-776 | None |
| A0A7R9DQZ2 | 31-204 | None |
| A0A438E0B7 | 76-234 | None |
| A0A3P6SK36 | 129-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.