DPCstruct | MC2531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 133 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14107 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2I4D1 | 15-123 | LEGEHFYVVRGAVLKCSEGSDPGVLNLPTSHGVYIKDQPVLHVMDAVPIDNISHFGFCKKTGGVCEPLTCGPWTDGKKDVLIDEQPA… |
| R5KDN0 | 2-125 | VYITAGTQCMCTYGTAPSVLNVTSQSTVLMGNKPVATIADCAPNTNLPPFALCISLQNPAVQAATAAALGVLTPQPCTLVPAGTWRQ… |
| G1VIZ5 | 1-87 | None |
| A0A5N7Z1B8 | 5-145 | None |
| A0A3N2F922 | 2-127 | None |
| D1QPY4 | 72-197 | None |
| K0XNG9 | 10-135 | None |
| A0A1M6Y3P5 | 1-157 | None |
| A0A5B1BHM9 | 12-133 | None |
| A0A376BXK2 | 43-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.