DPCstruct | MC25306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 424 ± 65 aa |
| Standard deviation of domain lengths | 64.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0S7Q8 | 221-590 | LRPVDLVNLYSVSRDFHDTLNNQMRSFVLAWASHMAPIGSHIYSSPMYYKYFTKDPAGNLVTELDKEAMKPKPGQPSLPDMWPFNRD… |
| A0A2S7QBC8 | 22-408 | SAASSTNRTILSEDELAALGIIPDTPPPDSDVEEELLPRAPKNQSPNTPHPFPGIFNAILLYPHILFELTLHFSPRQIVTLYSISST… |
| A0A1J9QX97 | 445-912 | None |
| A0A2N6NND7 | 1-452 | None |
| A0A4Z1FCG2 | 610-1020 | None |
| A0A5N5X7J8 | 133-521 | None |
| M2MCB4 | 117-590 | None |
| A0A0G4KFV2 | 131-477 | None |
| A0A0S7DVB4 | 318-736 | None |
| A0A1L9VGZ6 | 202-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.