DPCstruct | MC25305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 138 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7QB94 | 2-146 | TRILNQPMNATTSYIPGSSSYPKCASEMIMLFWEITQCNKRFRSFIIDTDRSHDFVILILFYSLEYRLDASKQGIVRMCVFILQTLS… |
| A0A833ZHV3 | 137-271 | QTYLPNSTKKIQFHQELLVLFWKLCDFNKKFLFFVLKSSDVLDILVPILYFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNK… |
| A0A098VSX6 | 181-316 | None |
| A0A5K3FAR7 | 331-458 | None |
| A0A162N2T2 | 600-747 | None |
| A0A820KDM8 | 11-129 | None |
| S3CHD4 | 345-492 | None |
| A0A0R3Q957 | 47-192 | None |
| A0A1V6QFX9 | 347-487 | None |
| A0A842ZGA0 | 100-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.