DPCstruct | MC25301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B2W2W3 | 1-84 | MKYGVLVHIAPTTASCAGAEFPEECTDATQVARAINAAFETYGISSLRERVSLVADILFESGNFKYNKNHYPGRPGQGTGMMAM |
| A0A423X6K3 | 20-129 | LPTTPSPTRTLGKRDSTQVIEDIMPSSSSCAGRGDQCRTAAQAAPHLVKAMQDYGIGTNMEQAGILALVAYESGEMQYSKNLNNAAA… |
| A0A317A4V3 | 9-97 | None |
| A0A6A7AR16 | 1-84 | None |
| A0A2T7A2U7 | 5-131 | None |
| N4X903 | 1-115 | None |
| A0A0S6XSF5 | 1-116 | None |
| A0A1Y6L719 | 1-113 | None |
| A0A517KXC2 | 100-212 | None |
| A0A0D2C7Z7 | 55-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.