DPCstruct | MC2530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 785 ± 184 aa |
| Standard deviation of domain lengths | 183.84 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0001- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ZB90 | 188-771 | PVDLGSMGYEGEESMYLNKDVLQQALDAEGLTLDFYRGYNLTHHNPKQYFDSIDTISLADLFLCEETDFYKPEAMAAYATWTGDAAG… |
| A0A812NBL1 | 77-635 | PENVGSMGYVGENSLCVNGAVRNAAYSAEGLALEFYKSYNASFHSAYQFFDRLSDLRADDFLPCNTSNTKFTLHVQLEAYVRWTGDS… |
| A0A812V8Z3 | 23-845 | None |
| A0A812L716 | 1-982 | None |
| A0A812ZME3 | 17-994 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.