DPCstruct | MC253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 184 ± 14 aa |
| Standard deviation of domain lengths | 14.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11843 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329P2W9 | 77-251 | PRTDREIENRLRHEVEQERLTSIDRRLIREMDENGIVSAIDRNAFQQTLRAGRLKKLARLGLAEELRPGGWRLEEGLEDTLRRMGER… |
| A0A1G3JIX5 | 3-170 | SLADPGPISVSQQISADGPTWLDEQLILGRPGKADAGLSLEVRQALHDRMAHLVRQGIASQQDGQVLLPSNLLDRLHRHEFEKVQES… |
| A0A257JST5 | 381-536 | None |
| F3S285 | 144-327 | None |
| A0A401WYY5 | 9-202 | None |
| A0A2K9NLI2 | 206-408 | None |
| A0A2E4R082 | 156-343 | None |
| Q0ZB26 | 153-323 | None |
| A0A0L1KDX6 | 337-500 | None |
| A0A8B3IUF9 | 76-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.