DPCstruct | MC25299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 161 ± 14 aa |
| Standard deviation of domain lengths | 14.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3Q6B1 | 56-209 | YMKIQYFLIVATCFLYLVAAGLFSKAVWFLQNFVWSGLVGGDVAETGDGPGSYDVRQSVWHVNCCNGQTSGGWMIFNAIFGWQNSAT… |
| A0A1D2VIF9 | 287-435 | SIQKFLVYSTCFLYVVASGLFSKGFWNFELQKYIDDCNGQDLTEVGNGPGSYDISKSIWHVNCCNGQTDGLWMLAAAIFGWTNSATY… |
| A0A0D0VQM2 | 62-248 | None |
| M5GBD3 | 162-318 | None |
| A0A2P2H588 | 1-172 | None |
| A0A812PBX1 | 272-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.