DPCstruct | MC25298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146HCR8 | 238-354 | SASEQPVALPSAPQTILAEGIVLQPPLSRRGTGPGIVAFLPPDSAFQLSSKPAPLDPPPTVKWAEEGYAVVGIVGGDVASNLKIALN… |
| A0A2S7NUG1 | 1-135 | MADPPVAQLNPSENRTPIPLSFHPVTIDANVALQEPLTRRGIGPGLLLITPAKYGGREARNDGGVQKTLDPEPLQKWAEEGFVVVEV… |
| A0A0D7B1A0 | 34-162 | None |
| X0J2L0 | 1-101 | None |
| A0A401KUE5 | 7-132 | None |
| A0A4Q7JZL7 | 3-113 | None |
| A0A2J6TIB8 | 5-113 | None |
| A0A366R1Q3 | 7-106 | None |
| A0A1V8SYV0 | 658-771 | None |
| Q5B254 | 3-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.