DPCstruct | MC25296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 209 ± 45 aa |
| Standard deviation of domain lengths | 44.78 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.59 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF11708- CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7PX22 | 61-266 | HIPQYISTAPWYFGSGGPTLKHQRPQPEKQSSFNHLNEHYARGQKGSVATRYRKGACENCGGLGHKKKDCVERPRKVGAKFNARNIA… |
| A0A0N5B5J3 | 75-211 | ISTDGPTLQHQRPHPDRQKTDIEINEWYNRGTTGVRAKKYRKGACENCGAMTHKKKDCFERPRKVGAKYTNEKIAEDEYIQPDVSYM… |
| S6BPJ4 | 45-232 | None |
| A0A0R3QIJ3 | 1-163 | None |
| A0A4V3WQS1 | 1-208 | None |
| A0A835GWH6 | 30-205 | None |
| A0A7R9KR91 | 621-814 | None |
| A0A7S1QWA8 | 89-312 | None |
| A0A6V7NKH6 | 2-218 | None |
| A0A2G5TJ85 | 59-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.