DPCstruct | MC25295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 205 ± 16 aa |
| Standard deviation of domain lengths | 16.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383ZGX8 | 154-356 | TGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKM… |
| A0A6I9XTH0 | 65-265 | TGTKLDSSGVAFAVVGACQALGLYDVHLALSEDHAWVVFGKDGEQTAEVTWHGKGNEDRRGQTVNSGVAERSWLYLKGSYLRCTRQM… |
| Q0IHQ0 | 266-463 | None |
| A0A6G0HIB0 | 59-261 | None |
| A0A177AWE0 | 164-344 | None |
| A0A452IQ27 | 147-399 | None |
| A0A7J7QML1 | 2-212 | None |
| A0A7M7JYC7 | 147-344 | None |
| A0A1D2A7T5 | 174-398 | None |
| A0A6P6XPJ2 | 499-698 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.