DPCstruct | MC2529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 462 ± 49 aa |
| Standard deviation of domain lengths | 48.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0070- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6NJC9 | 8-386 | EFTGLILVSGVDEPGITSKVLSKLAEFSVQIIDIKQIVTADRLLQTILINLLPDHALAVESDLLELANNSSFDVAIDFSQHPNNQEQ… |
| A0A1J4X6V6 | 1-429 | MLNFNLLVESPADPQALLNDGFRGDGIRITRRHLLTLDSVCLISAHLRVKGEEHQSAYEQAMARIDTTFAGEGIAVRSRPASPGGRM… |
| A0A2U3E0F0 | 597-1111 | None |
| A0A813BX19 | 96-573 | None |
| M1UVR9 | 67-569 | None |
| A0A2P6VX95 | 1-510 | None |
| A0A5C4XZH5 | 1-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.