DPCstruct | MC25289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 197 ± 23 aa |
| Standard deviation of domain lengths | 22.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1HA91 | 399-618 | HLNMNEISTLMDLLTDDNIESQSVEYYVNQISQNFPKANNFKVGSAIVALITNNLIQKPAQRLVALSVLNELYRGEPFAHNPFSAFI… |
| A0A3R7MFY3 | 1-164 | MALTANELTTLLGILSEETTESATLEQIIHQIYQNFTKQDYFKLGTALVFLLQQPDLLPSPAQRLCAVTILHELYRGEPPPNNPFLP… |
| A0A6P5RHP9 | 5-195 | None |
| R0HAL6 | 1-204 | None |
| A0A2G8LDZ5 | 3-170 | None |
| A0A5J5CDD0 | 1-211 | None |
| A0A1S3YR74 | 1-196 | None |
| A0A3B6LIU9 | 9-235 | None |
| A0A2H1C0T6 | 1-169 | None |
| A0A835VCD5 | 66-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.